Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR6_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR6
Cross References:
References
UniProtP51684 | P78553 | Q92846
EMBLU45984 | Z79784 | U60000 | U68030 | U68032 | AY242126 | AL121935 | BC037960
InterProIPR000276 | IPR004067 | IPR000355 | IPR017452
PRODOM
GENEID1235
MIM601835
PRINTSPR00657 | PR01529 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR6_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 6; Short=C-C CKR-6; Short=CC-CKR-6; Short=CCR-6;AltName: Full=LARC receptor;AltName: Full=GPR-CY4; Short=GPRCY4;AltName: Full=Chemokine receptor-like 3; Short=CKR-L3;AltName: Full=DRY6;AltName: Full=G-protein coupled receptor 29;AltName: CD_antigen=CD196
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR6 | CKRL3,CMKBR6,GPR29,STRL2
FunctionReceptor for a C-C type chemokine
Fragment0
Sequence
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFG
LLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKL
LKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISS
STFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKT
LVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTV
TEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQT
SETADNDNASSFTM
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o9294137
2Galpha-i2_Homo sapiensGi/o9294137
3Galpha-z_Homo sapiensGi/o9294137
4Galpha-o_Homo sapiensGi/o9294137
5Galpha-i1_Homo sapiensGi/o9294137
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level