Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR7_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR7
Cross References:
References
UniProtP32248
EMBLL08176 | L31584 | L31582 | L31583 | L31581 | AY587876 | BC035343
InterProIPR000276 | IPR001718 | IPR000355 | IPR017452
PRODOM
GENEID1236
MIM600242
PRINTSPR00657 | PR00641 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR7_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 7; Short=C-C CKR-7; Short=CC-CKR-7; Short=CCR-7;AltName: Full=MIP-3 beta receptor;AltName: Full=EBV-induced G-protein coupled receptor 1; Short=EBI1;AltName: Full=BLR2;AltName: Full=CDw197;AltName: CD_antigen=CD197;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR7 | CMKBR7,EBI1,EVI
FunctionReceptor for the MIP-3-beta chemokine
Fragment0
Sequence
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH
IRRSSMSVEAETTTTFSP
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o9153236
2Galpha-o_Homo sapiensGi/o9153236
3Galpha-i2_Homo sapiensGi/o9153236
4Galpha-z_Homo sapiensGi/o9153236
5Galpha-i1_Homo sapiensGi/o9153236
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level