Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR8_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR8
Cross References:
References
UniProtP51685 | Q3KNQ8 | Q9BYX5
EMBLZ79782 | Y08456 | U45983 | AF005210 | U62556 | D49919 | AY016370 | BC069067 | BC074743 | BC107159
InterProIPR000276 | IPR004068 | IPR000355 | IPR017452
PRODOM
GENEID1237
MIM601834
PRINTSPR00657 | PR01530 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR8_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 8; Short=C-C CKR-8; Short=CC-CKR-8; Short=CCR-8;AltName: Full=GPR-CY6; Short=GPRCY6;AltName: Full=Chemokine receptor-like 1; Short=CKR-L1;AltName: Full=TER1;AltName: Full=CMKBRL2;AltName: Full=CC-chemokine receptor CHEMR1;AltName: CD_antigen=CDw198
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR8 | CKRL1,CMKBR8,CMKBRL
FunctionReceptor for the chemokine CCL1/SCYA1/I-309
Fragment0
Sequence
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL
VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS
MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV
LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV
LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY
AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o9207005
2Galpha-i2_Homo sapiensGi/o9207005
3Galpha-i3_Homo sapiensGi/o9207005
4Galpha-o_Homo sapiensGi/o9207005
5Galpha-z_Homo sapiensGi/o9207005
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level