Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-1B_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-1B
Cross References:
References
UniProtP28222 | Q4VAY7
EMBLM89478 | D10995 | M83180 | L09732 | M81590 | M75128 | AB041370 | AY225227 | AL049595 | BC069065 | BC096206 | BC096207 | BC096208
InterProIPR002147 | IPR002231 | IPR000276 | IPR017452
PRODOM
GENEID3351
MIM182131
PRINTSPR00513 | PR01101 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-1B_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 1B;AltName: Full=5-HT-1D-beta; Short=5-HT-1B; Short=5-HT1B;AltName: Full=Serotonin receptor 1B;AltName: Full=Serotonin 1D beta receptor;AltName: Full=S12
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR1B | HTR1D
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
2Galpha-i2_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
3Galpha-z_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
4Galpha-o_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
5Galpha-i3_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level