Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCR9_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCR9
Cross References:
References
UniProtP51686 | Q4VBM3 | Q549E0 | Q9UQQ6
EMBLAJ132337 | AF145439 | AF145440 | U45982 | AY242127 | BC069678 | BC095516
InterProIPR000276 | IPR004069 | IPR000355 | IPR017452
PRODOM
GENEID10803
MIM604738
PRINTSPR00657 | PR01531 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCR9_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor type 9; Short=C-C CKR-9; Short=CC-CKR-9; Short=CCR-9;AltName: Full=GPR-9-6;AltName: Full=G-protein coupled receptor 28;AltName: CD_antigen=CDw199
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCR9 | CMKBR9,GPR2
FunctionReceptor for chemokine SCYA25/TECK
Fragment0
Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o10229797
2Galpha-i2_Homo sapiensGi/o10229797
3Galpha-z_Homo sapiensGi/o10229797
4Galpha-i1_Homo sapiensGi/o10229797
5Galpha-i3_Homo sapiensGi/o10229797
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level