Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CCRL2_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCCRL2
Cross References:
References
UniProtO00421 | O75307 | Q4VBB0 | Q6IPX0 | Q96KP5 | Q9UPG0
EMBLU97123 | AF014958 | AF015524 | AF015525 | AJ344142 | AY337001 | U95626 | BC025717 | BC071682 | BC096075 | BC096076 | BC099623
InterProIPR000276 | IPR000355 | IPR017452
PRODOM
GENEID9034
MIM608379
PRINTSPR00657 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CCRL2_Homo sapiens
DescriptionRecName: Full=C-C chemokine receptor-like 2;AltName: Full=Putative MCP-1 chemokine receptor;AltName: Full=Chemokine receptor CCR11;AltName: Full=Chemokine receptor X
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCCRL2 | CCR11,CCR6,CKRX,CRAM,HC
FunctionReceptor for CCL2, CCL5, CCL7 and CCL8 (By similarity)
Fragment0
Sequence
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV
LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF
NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK
CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV
FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY
AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o8530354
2Galpha-z_Homo sapiensGi/o8530354
3Galpha-i3_Homo sapiensGi/o8530354
4Galpha-i2_Homo sapiensGi/o8530354
5Galpha-i1_Homo sapiensGi/o8530354
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level