Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CX3CR1_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCX3CR1
Cross References:
References
UniProtP49238 | A0N0N6 | B2R5Z4
EMBLU20350 | U28934 | AY016370 | AK312373 | EF064744 | EU006531 | CH471055 | BC028078
InterProIPR000276 | IPR005387 | IPR017452
PRODOM
GENEID1524
MIM601470 | 609423
PRINTSPR01562 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CX3CR1_Homo sapiens
DescriptionRecName: Full=CX3C chemokine receptor 1; Short=C-X3-C CKR-1; Short=CX3CR1;AltName: Full=Fractalkine receptor;AltName: Full=G-protein coupled receptor 13;AltName: Full=V28;AltName: Full=Beta chemokine receptor-like 1;AltName: Full=CMK-BRL-1;AltName: Full=CMKBLR1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCX3CR1 | CMKBRL1,GPR1
FunctionReceptor for the CX3C chemokine fractalkine and mediatess both its adhesive and migratory functions
Fragment0
Sequence
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK
KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI
TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP
EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF
FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF
RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o9390561
2Galpha-i3_Homo sapiensGi/o9390561
3Galpha-z_Homo sapiensGi/o9390561
4Galpha-i2_Homo sapiensGi/o9390561
5Galpha-i1_Homo sapiensGi/o9390561
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level