Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CXCR1_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCXCR1
Cross References:
References
UniProtP25024 | B2R6Q3 | Q2YEF8 | Q2YEG4 | Q2YEG5 | Q2YEG7 | Q2YEG8 | Q53R18
EMBLL19591 | L19592 | M68932 | X65858 | U11870 | AY916762 | AY916763 | AY916764 | AY916765 | AY916766 | AY916769 | AY916772 | AY916773 | CR541994 | CR542029 | AK312668 | AY651785 | AC097483 | CH471063 | BC028221 | BC072397 | AB032728 | AB032729 | AB032730 | AB032731 | AB032732
InterProIPR000276 | IPR017452 | IPR000174 | IPR001355
PRODOM
GENEID3577
MIM146929
PRINTSPR00237 | PR00427 | PR00572
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CXCR1_Homo sapiens
DescriptionRecName: Full=High affinity interleukin-8 receptor A; Short=IL-8R A;AltName: Full=IL-8 receptor type 1;AltName: Full=CXCR-1;AltName: Full=CDw128a;AltName: CD_antigen=CD181
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneIL8RA | CMKAR1,CXCR
FunctionReceptor to interleukin-8, which is a powerfuls neutrophils chemotactic factor
Fragment0
Sequence
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o9390561
2Galpha-i3_Homo sapiensGi/o9390561
3Galpha-o_Homo sapiensGi/o9390561
4Galpha-i2_Homo sapiensGi/o9390561
5Galpha-z_Homo sapiensGi/o9390561
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level