Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CXCR2_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCXCR2
Cross References:
References
UniProtP25025 | Q8IUZ1 | Q9P2T6 | Q9P2T7
EMBLM73969 | M94582 | M99412 | L19593 | U11869 | AY714242 | BC037961 | AB032733 | AB032734
InterProIPR000276 | IPR017452 | IPR000174 | IPR000057
PRODOM
GENEID3579
MIM146928
PRINTSPR00237 | PR00427 | PR00573
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CXCR2_Homo sapiens
DescriptionRecName: Full=High affinity interleukin-8 receptor B; Short=IL-8R B;AltName: Full=CXCR-2;AltName: Full=GRO/MGSA receptor;AltName: Full=IL-8 receptor type 2;AltName: Full=CDw128b;AltName: CD_antigen=CD182
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneIL8RB | CXCR
FunctionReceptor for interleukin-8 which is a powerfuls neutrophil chemotactic factor
Fragment0
Sequence
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o1891716
2Galpha-i2_Homo sapiensGi/o1891716
3Galpha-i3_Homo sapiensGi/o1891716
4Galpha-z_Homo sapiensGi/o1891716
5Galpha-o_Homo sapiensGi/o1891716
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level