Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CXCR3_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCXCR3
Cross References:
References
UniProtP49682 | O15185 | Q7Z710 | Q9P2T4 | Q9P2T5
EMBLX95876 | AF469635 | Z79783 | AY242128 | BC034403 | U32674 | AB032735 | AB032736
InterProIPR000276 | IPR000355 | IPR004070 | IPR017452
PRODOM
GENEID2833
MIM300574
PRINTSPR00657 | PR01532 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CXCR3_Homo sapiens
DescriptionRecName: Full=C-X-C chemokine receptor type 3; Short=CXC-R3; Short=CXCR-3;AltName: Full=Interferon-inducible protein 10 receptor; Short=IP-10 receptor;AltName: Full=CKR-L2;AltName: Full=G protein-coupled receptor 9;AltName: CD_antigen=CD183
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCXCR3 | GPR
FunctionReceptor for CXCL9, CXCL10 and CXCL11 and mediates thes proliferation of human mesangial cells (HMC)
Fragment0
Sequence
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o9653165
2Galpha-i3_Homo sapiensGi/o9653165
3Galpha-z_Homo sapiensGi/o9653165
4Galpha-i1_Homo sapiensGi/o9653165
5Galpha-o_Homo sapiensGi/o9653165
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level