Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CXCR4_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCXCR4
Cross References:
References
UniProtP61073 | O60835 | P30991 | P56438 | Q9UKN2
EMBLL01639 | M99293 | X71635 | L06797 | D10924 | AF005058 | AF052572 | AF025375 | Y14739 | AJ224869 | AF147204 | AY242129 | BT006660 | AY728138 | BC020968
InterProIPR000276 | IPR000355 | IPR001277 | IPR017452
PRODOM
GENEID7852
MIM162643 | 193670
PRINTSPR00657 | PR00645 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CXCR4_Homo sapiens
DescriptionRecName: Full=C-X-C chemokine receptor type 4; Short=CXC-R4; Short=CXCR-4;AltName: Full=Stromal cell-derived factor 1 receptor; Short=SDF-1 receptor;AltName: Full=Fusin;AltName: Full=Leukocyte-derived seven transmembrane domain receptor; Short=LESTR;AltName: Full=LCR1;AltName: Full=FB22;AltName: Full=NPYRL;AltName: Full=HM89;AltName: CD_antigen=CD184
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCXCR
FunctionReceptor for the C-X-C chemokine CXCL12/SDF-1
Fragment0
Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o8629022
2Galpha-i1_Homo sapiensGi/o8629022
3Galpha-o_Homo sapiensGi/o8629022
4Galpha-i2_Homo sapiensGi/o8629022
5Galpha-i3_Homo sapiensGi/o8629022
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level