Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CXCR5_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCXCR5
Cross References:
References
UniProtP32302 | Q14811
EMBLX68149 | X68829
InterProIPR000276 | IPR001053 | IPR017452
PRODOM
GENEID643
MIM601613
PRINTSPR00564 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CXCR5_Homo sapiens
DescriptionRecName: Full=C-X-C chemokine receptor type 5; Short=CXC-R5; Short=CXCR-5;AltName: Full=Burkitt lymphoma receptor 1;AltName: Full=Monocyte-derived receptor 15; Short=MDR-15;AltName: CD_antigen=CD185
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCXCR5 | BLR1,MDR1
FunctionCytokine receptor that binds to B-lymphocytes chemoattractant (BLC)
Fragment0
Sequence
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSL
IFLLGVIGNVLVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTF
LCKTVIALHKVNFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLL
ALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHVAGFLLPMLVMGWCYVG
VVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSL
PVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSL
SESENATSLTTF
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o11882900
2Galpha-i1_Homo sapiensGi/o11882900
3Galpha-i2_Homo sapiensGi/o11882900
4Galpha-o_Homo sapiensGi/o11882900
5Galpha-z_Homo sapiensGi/o11882900
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level