Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CXCR6_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCXCR6
Cross References:
References
UniProtO00574 | O00575 | Q9HCA5
EMBLAF007545 | U73529 | U73531 | Y13248 | AF029759 | AY322543 | BC033584
InterProIPR000276 | IPR000355 | IPR002235 | IPR017452
PRODOM
GENEID10663
MIM605163
PRINTSPR00657 | PR01105 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CXCR6_Homo sapiens
DescriptionRecName: Full=C-X-C chemokine receptor type 6; Short=CXC-R6; Short=CXCR-6;AltName: Full=G-protein coupled receptor bonzo;AltName: Full=G-protein coupled receptor STRL33;AltName: Full=CDw186;AltName: CD_antigen=CD186
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCXCR6 | BONZO,STRL33,TYMST
FunctionReceptor for the C-X-C chemokine CXCL16
Fragment0
Sequence
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH
KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL
TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC
GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF
LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o14625285
2Galpha-z_Homo sapiensGi/o14625285
3Galpha-i1_Homo sapiensGi/o14625285
4Galpha-i2_Homo sapiensGi/o14625285
5Galpha-i3_Homo sapiensGi/o14625285
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level