Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-1D_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-1D
Cross References:
References
UniProtP28221
EMBLM89955 | M81589 | AF498979 | BT007027 | AL049576 | BC007720
InterProIPR000505 | IPR002231 | IPR000276 | IPR017452
PRODOM
GENEID3352
MIM182133
PRINTSPR00514 | PR01101 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-1D_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 1D; Short=5-HT-1D;AltName: Full=5-HT-1D-alpha;AltName: Full=Serotonin receptor 1D
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR1D | HTR1DA,HTR
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
2Galpha-i3_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
3Galpha-i1_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
4Galpha-z_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
5Galpha-o_Homo sapiensGi/o3138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level