Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CXCR7_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCXCR7
Cross References:
References
UniProtP25106 | A8K6J4 | Q53RV4 | Q8NE10 | Q92938 | Q92986
EMBLM64749 | U73141 | U67784 | AF030297 | DQ822477 | AK291659 | AC079611 | CH471063 | BC036661
InterProIPR000276 | IPR017452 | IPR001416
PRODOM
GENEID57007
MIM610376
PRINTSPR00237 | PR00646
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CXCR7_Homo sapiens
DescriptionRecName: Full=C-X-C chemokine receptor type 7; Short=CXC-R7; Short=CXCR-7;AltName: Full=G-protein coupled receptor RDC1 homolog; Short=RDC-1;AltName: Full=Chemokine orphan receptor 1;AltName: Full=G-protein coupled receptor 159
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCXCR7 | CMKOR1,GPR159,RDC
FunctionReceptor for CXCL12/SDF1
Fragment0
Sequence
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMI
ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVT
HLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDT
YYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAIS
ASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT
QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQS
TK
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o9632725
2Galpha-o_Homo sapiensGi/o9632725
3Galpha-i1_Homo sapiensGi/o9632725
4Galpha-i2_Homo sapiensGi/o9632725
5Galpha-i3_Homo sapiensGi/o9632725
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level