Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_XCR1_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyXCR1
Cross References:
References
UniProtP46094
EMBLL36149 | AY275469 | BC069075 | BC069589
InterProIPR000276 | IPR017452 | IPR005393
PRODOM
GENEID2829
MIM600552
PRINTSPR00237 | PR01568
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_XCR1_Homo sapiens
DescriptionRecName: Full=Chemokine XC receptor 1;AltName: Full=XC chemokine receptor 1;AltName: Full=Lymphotactin receptor;AltName: Full=G-protein coupled receptor 5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneXCR1 | CCXCR1,GPR
FunctionReceptor for chemokines SCYC1 and SCYC2
Fragment0
Sequence
MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE
SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL
TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL
TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP
YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH
VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o9632725
2Galpha-i3_Homo sapiensGi/o9632725
3Galpha-i2_Homo sapiensGi/o9632725
4Galpha-z_Homo sapiensGi/o9632725
5Galpha-o_Homo sapiensGi/o9632725
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level