Quick search:







Description Entry page for GPCR - 'CHEMOKINE RECEPTORS_CMKLR1_Homo sapiens'
ClassCLASS A
FamilyCHEMOKINE RECEPTORS
Sub-FamilyCMKLR1
Cross References:
References
UniProtQ99788 | A8K6Y5 | O75748 | Q3KP37 | Q99789
EMBLU79526 | U79527 | Y14838 | AB065871 | AY497547 | AK291800 | CH471054 | BC106927 | BC106928
InterProIPR000276 | IPR002258 | IPR017452
PRODOM
GENEID1240
MIM602351
PRINTSPR01126 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameCHEMOKINE RECEPTORS_CMKLR1_Homo sapiens
DescriptionRecName: Full=Chemokine receptor-like 1;AltName: Full=G-protein coupled receptor DEZ;AltName: Full=G-protein coupled receptor ChemR23
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCMKLR1 | CHEMR23,DE
FunctionOrphan receptor
Fragment0
Sequence
MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGL
VIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLI
HNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDT
ANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACY
LTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPL
ATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMN
ERTSMNERETGML
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o7679328
2Galpha-o_Homo sapiensGi/o7679328
3Galpha-i2_Homo sapiensGi/o7679328
4Galpha-z_Homo sapiensGi/o7679328
5Galpha-i3_Homo sapiensGi/o7679328
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level