Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-2A_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-2A
Cross References:
References
UniProtP28223 | B2RAC5 | Q5T8C0
EMBLX57830 | S42168 | S42165 | S42167 | S71229 | AF498982 | AK314132 | AL160397 | AL136958 | AL136958 | AL160397 | CH471075 | BC069356 | BC069576 | BC074848 | BC074849 | BC096839 | M86841 | S50130 | S49737 | S50113
InterProIPR000455 | IPR002231 | IPR000276 | IPR017452
PRODOM
GENEID3356
MIM182135
PRINTSPR00516 | PR01101 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-2A_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 2A; Short=5-HT-2A; Short=5-HT-2;AltName: Full=Serotonin receptor 2A
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR2A | HTR
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-q_Homo sapiensGq/113138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
2Galpha-15_Homo sapiensGq/113138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
3Galpha-14_Homo sapiensGq/113138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
4Galpha-11_Homo sapiensGq/113138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level