Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-2B_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-2B
Cross References:
References
UniProtP41595 | B2R9D5 | Q53TI1 | Q62221 | Q6P523
EMBLX77307 | Z36748 | AF156160 | AF156158 | AF156159 | AY136751 | AC009407 | AK313741 | CH471063 | BC063123
InterProIPR000482 | IPR002231 | IPR000276 | IPR017452
PRODOM
GENEID3357
MIM601122
PRINTSPR00651 | PR01101 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-2B_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 2B; Short=5-HT-2B;AltName: Full=Serotonin receptor 2B
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR2
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/113138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
2Galpha-14_Homo sapiensGq/113138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
3Galpha-q_Homo sapiensGq/113138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
4Galpha-11_Homo sapiensGq/113138543 | 1351684 | 1565658 | 1608964 | 8384716 | 1765383 | 8786115
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level