Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-2C_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-2C
Cross References:
References
UniProtP28335 | Q5VUF8 | Q9NP28
EMBLM81778 | X80763 | U49516 | AF208053 | AF498983 | AC004822 | AL355812 | AL590097 | AC004822 | AL590097 | AC004822 | AL355812 | BC095543
InterProIPR000377 | IPR002231 | IPR000276 | IPR017452
PRODOM
GENEID3358
MIM312861
PRINTSPR00517 | PR01101 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-2C_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 2C; Short=5-HTR2C; Short=5-HT-2C; Short=5-HT2C;AltName: Full=5HT-1C;AltName: Full=Serotonin receptor 2C
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR2C | HTR1
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-12_Homo sapiensG12/131302605
2Galpha-13_Homo sapiensG12/131302605
3Galpha-14_Homo sapiensGq/111302605
4Galpha-q_Homo sapiensGq/111302605
5Galpha-11_Homo sapiensGq/111302605
6Galpha-15_Homo sapiensGq/111302605
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level