Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-4_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-4
Cross References:
References
UniProtQ13639 | Q96KH9 | Q96KI0 | Q9H199 | Q9NY73 | Q9UBM6 | Q9UBT4 | Q9UE22
EMBLY12505 | Y12506 | Y12507 | Y10437 | Y08756 | Y09586 | Y13584 | AJ011371 | AJ243213 | AJ278979 | AJ278981 | AJ278982 | BC074755 | Z48150
InterProIPR001520 | IPR000276 | IPR017452
PRODOM
GENEID3360
MIM602164
PRINTSPR01059 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-4_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 4; Short=5-HT-4; Short=5-HT4;AltName: Full=Serotonin receptor 4
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-13_Homo sapiensG12/132849052
2Galpha-12_Homo sapiensG12/132849052
3Galpha-s_Homo sapiens_1Gs2849052
4Galpha-s_Homo sapiens_2Gs2849052
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level