Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-5A_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-5A
Cross References:
References
UniProtP47898 | Q2M2D2
EMBLX81411 | X81412 | AF498985 | BC112021
InterProIPR001397 | IPR002231 | IPR000276 | IPR017452
PRODOM
GENEID3361
MIM601305
PRINTSPR00518 | PR01101 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-5A_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 5A; Short=5-HT-5A; Short=5-HT-5;AltName: Full=Serotonin receptor 5A
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR5
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o7988681
2Galpha-i3_Homo sapiensGi/o7988681
3Galpha-z_Homo sapiensGi/o7988681
4Galpha-i1_Homo sapiensGi/o7988681
5Galpha-o_Homo sapiensGi/o7988681
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level