Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-6_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-6
Cross References:
References
UniProtP50406 | Q13640 | Q5TGZ1
EMBLL41147 | AY429105 | AL031727 | CH471134 | BC074995 | BC074996 | Z49119
InterProIPR000276 | IPR017452
PRODOM
GENEID3362
MIM601109
PRINTSPR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-6_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 6; Short=5-HT-6;AltName: Full=Serotonin receptor 6
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs8522988
2Galpha-s_Homo sapiens_2Gs8522988
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level