Quick search:







Description Entry page for GPCR - '5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-7_Homo sapiens'
ClassCLASS A
Family5-HYDROXYTRYPTAMINE RECEPTORS
Sub-Family5-HT-7
Cross References:
References
UniProtP34969 | B5BUP6 | P78336 | P78372 | P78516 | Q5VX01
EMBLU68487 | U68488 | U68492 | U68493 | U68492 | U68493 | U68492 | L21195 | AY493988 | AB451482 | AL360011 | CH471066 | BC047526
InterProIPR001069 | IPR000276 | IPR017452
PRODOM
GENEID3363
MIM182137
PRINTSPR00652 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
Name5-HYDROXYTRYPTAMINE RECEPTORS_5-HT-7_Homo sapiens
DescriptionRecName: Full=5-hydroxytryptamine receptor 7; Short=5-HT-7; Short=5HT7;AltName: Full=5-HT-X;AltName: Full=Serotonin receptor 7
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneHTR
FunctionThis is one of the several different receptors for 5-s hydroxytryptamine (serotonin), a biogenic hormone that functionss as a neurotransmitter, a hormone, and a mitogen
Fragment0
Sequence
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs8397408
2Galpha-s_Homo sapiens_2Gs8397408
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level