Quick search:







Description Entry page for GPCR - 'ADENOSINE RECEPTORS_A1_Homo sapiens'
ClassCLASS A
FamilyADENOSINE RECEPTORS
Sub-FamilyA1
Cross References:
References
UniProtP30542 | A6NFY5 | A6NGP4 | A8K1L3 | B3KXQ4 | Q6FHK3 | Q8TAM8
EMBLS45235 | S56143 | L22214 | X68485 | AB004662 | AK127752 | AK289928 | AY136746 | BT019854 | CR541749 | AC105940 | CH471067 | BC026340
InterProIPR000276 | IPR001068 | IPR001634 | IPR017452
PRODOM
GENEID134
MIM102775
PRINTSPR00552 | PR00424 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADENOSINE RECEPTORS_A1_Homo sapiens
DescriptionRecName: Full=Adenosine receptor A1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADORA
FunctionReceptor for adenosine
Fragment0
Sequence
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o1662665
2Galpha-o_Homo sapiensGi/o1662665
3Galpha-i1_Homo sapiensGi/o1662665
4Galpha-i3_Homo sapiensGi/o1662665
5Galpha-i2_Homo sapiensGi/o1662665
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level