Quick search:







Description Entry page for GPCR - 'ADENOSINE RECEPTORS_A2A_Homo sapiens'
ClassCLASS A
FamilyADENOSINE RECEPTORS
Sub-FamilyA2A
Cross References:
References
UniProtP29274 | B2R7E0
EMBLM97370 | X68486 | S46950 | U40771 | U40770 | AY136747 | CR456367 | BT006999 | AK312946 | CH471095 | BC013780
InterProIPR000276 | IPR001513 | IPR001634 | IPR017452
PRODOM
GENEID135
MIM102776
PRINTSPR00553 | PR00424 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADENOSINE RECEPTORS_A2A_Homo sapiens
DescriptionRecName: Full=Adenosine receptor A2a
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADORA2A | ADORA
FunctionReceptor for adenosine
Fragment0
Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs1662665
2Galpha-s_Homo sapiens_2Gs1662665
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level