Quick search:







Description Entry page for GPCR - 'ADENOSINE RECEPTORS_A2B_Homo sapiens'
ClassCLASS A
FamilyADENOSINE RECEPTORS
Sub-FamilyA2B
Cross References:
References
UniProtP29275
EMBLM97759 | X68487 | AY136748 | BC025722
InterProIPR000276 | IPR001435 | IPR001634 | IPR017452
PRODOM
GENEID136
MIM600446
PRINTSPR00554 | PR00424 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADENOSINE RECEPTORS_A2B_Homo sapiens
DescriptionRecName: Full=Adenosine receptor A2b
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADORA2
FunctionReceptor for adenosine
Fragment0
Sequence
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs1662665
2Galpha-s_Homo sapiens_2Gs1662665
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level