Quick search:







Description Entry page for GPCR - 'ADENOSINE RECEPTORS_A3_Homo sapiens'
ClassCLASS A
FamilyADENOSINE RECEPTORS
Sub-FamilyA3
Cross References:
References
UniProtP33765 | A2A3P4 | Q6UWU0 | Q9BYZ1
EMBLL20463 | L22607 | X76981 | L77730 | L77729 | AY136749 | AY358644 | AL390195 | AL390195 | BC029831 | AY011231
InterProIPR000276 | IPR000466 | IPR001634 | IPR017452
PRODOM
GENEID140
MIM600445
PRINTSPR00555 | PR00424 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADENOSINE RECEPTORS_A3_Homo sapiens
DescriptionRecName: Full=Adenosine A3 receptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADORA3 | UNQ1931/PRO440
FunctionReceptor for adenosine
Fragment0
Sequence
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-z_Homo sapiensGi/o1323836
2Galpha-o_Homo sapiensGi/o1323836
3Galpha-i1_Homo sapiensGi/o1323836
4Galpha-i3_Homo sapiensGi/o1323836
5Galpha-i2_Homo sapiensGi/o1323836
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level