Quick search:







Description Entry page for GPCR - 'ADRENERGIC RECEPTORS_A1A_Homo sapiens'
ClassCLASS A
FamilyADRENERGIC RECEPTORS
Sub-FamilyA1A
Cross References:
References
UniProtP35348 | A8K0I3 | B0ZBD1 | B0ZBD4 | B0ZBD5 | B0ZBD9 | O60451 | Q13675
EMBLD25235 | U03866 | U02569 | L31774 | D32201 | D32202 | AF013261 | AY491775 | AY491776 | AY491777 | AY491778 | AY491779 | AY491780 | AY491781 | AB065703 | AY389505 | EU326301 | AK289548 | EU326301 | EU326301 | EU326301 | EU326301
InterProIPR000276 | IPR001004 | IPR002233 | IPR017452
PRODOM
GENEID148
MIM104221
PRINTSPR01103 | PR00557 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADRENERGIC RECEPTORS_A1A_Homo sapiens
DescriptionRecName: Full=Alpha-1A adrenergic receptor;AltName: Full=Alpha 1A-adrenoreceptor;AltName: Full=Alpha 1A-adrenoceptor;AltName: Full=Alpha-1C adrenergic receptor;AltName: Full=Alpha-adrenergic receptor 1c
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRA1A | ADRA1
FunctionThis alpha-adrenergic receptor mediates its action bys association with G proteins that activate a phosphatidylinositol-s calcium second messenger system
Fragment0
Sequence
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-13_Homo sapiensG12/138396931
2Galpha-11_Homo sapiensGq/118396931
3Galpha-14_Homo sapiensGq/118396931
4Galpha-15_Homo sapiensGq/118396931
5Galpha-q_Homo sapiensGq/118396931
6Galpha-12_Homo sapiensG12/138396931
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level