Quick search:







Description Entry page for GPCR - 'ADRENERGIC RECEPTORS_A1B_Homo sapiens'
ClassCLASS A
FamilyADRENERGIC RECEPTORS
Sub-FamilyA1B
Cross References:
References
UniProtP35368
EMBLM99589 | M99590 | U03865 | L31773
InterProIPR000276 | IPR001115 | IPR002233 | IPR017452
PRODOM
GENEID147
MIM104220
PRINTSPR01103 | PR00556 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADRENERGIC RECEPTORS_A1B_Homo sapiens
DescriptionRecName: Full=Alpha-1B adrenergic receptor;AltName: Full=Alpha 1B-adrenoreceptor;AltName: Full=Alpha 1B-adrenoceptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRA1
FunctionThis alpha-adrenergic receptor mediates its action bys association with G proteins that activate a phosphatidylinositol-s calcium second messenger system
Fragment0
Sequence
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-15_Homo sapiensGq/111662393
2Galpha-q_Homo sapiensGq/111662393
3Galpha-11_Homo sapiensGq/111662393
4Galpha-14_Homo sapiensGq/111662393
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level