Quick search:







Description Entry page for GPCR - 'ADRENERGIC RECEPTORS_A1D_Homo sapiens'
ClassCLASS A
FamilyADRENERGIC RECEPTORS
Sub-FamilyA1D
Cross References:
References
UniProtP25100 | Q9NPY0
EMBLM76446 | U03864 | L31772 | S70782 | D29952 | AL121675 | AL357040
InterProIPR000276 | IPR000363 | IPR002233 | IPR017452
PRODOM
GENEID146
MIM104219
PRINTSPR01103 | PR00240 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADRENERGIC RECEPTORS_A1D_Homo sapiens
DescriptionRecName: Full=Alpha-1D adrenergic receptor;AltName: Full=Alpha 1D-adrenoreceptor;AltName: Full=Alpha 1D-adrenoceptor;AltName: Full=Alpha-1A adrenergic receptor;AltName: Full=Alpha-adrenergic receptor 1a
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRA1D | ADRA1
FunctionThis alpha-adrenergic receptor mediates its effects through the influx of extracellular calcium
Fragment0
Sequence
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-q_Homo sapiensGq/111656955
2Galpha-11_Homo sapiensGq/111656955
3Galpha-14_Homo sapiensGq/111656955
4Galpha-15_Homo sapiensGq/111656955
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level