Quick search:







Description Entry page for GPCR - 'ADRENERGIC RECEPTORS_A2A_Homo sapiens'
ClassCLASS A
FamilyADRENERGIC RECEPTORS
Sub-FamilyA2A
Cross References:
References
UniProtP08913 | B0LPF6 | Q2I8G2 | Q2XN99 | Q86TH8 | Q9BZK1
EMBLM18415 | M23533 | AF281308 | AF316894 | DQ149926 | AF284095 | AF262016 | AY032736 | DQ285607 | EU332846 | AL158163 | BC035047 | BC050414
InterProIPR000276 | IPR001946 | IPR015695 | IPR002233 | IPR017452
PRODOM
GENEID150
MIM104210
PRINTSPR01103 | PR00558 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADRENERGIC RECEPTORS_A2A_Homo sapiens
DescriptionRecName: Full=Alpha-2A adrenergic receptor;AltName: Full=Alpha-2A adrenoreceptor;AltName: Full=Alpha-2A adrenoceptor; Short=Alpha-2AAR;AltName: Full=Alpha-2 adrenergic receptor subtype C10
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRA2A | ADRA2R,ADRA
FunctionAlpha-2 adrenergic receptors mediate the catecholamine-s induced inhibition of adenylate cyclase through the action of Gs proteins
Fragment0
Sequence
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-11_Homo sapiensGq/118662784
2Galpha-q_Homo sapiensGq/118662784
3Galpha-15_Homo sapiensGq/118662784
4Galpha-s_Homo sapiens_2Gs8662784
5Galpha-s_Homo sapiens_1Gs8662784
6Galpha-z_Homo sapiensGi/o8662784
7Galpha-o_Homo sapiensGi/o8662784
8Galpha-i1_Homo sapiensGi/o8662784
9Galpha-14_Homo sapiensGq/118662784
10Galpha-i3_Homo sapiensGi/o8662784
11Galpha-i2_Homo sapiensGi/o8662784
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level