Quick search:







Description Entry page for GPCR - 'ADRENERGIC RECEPTORS_A2B_Homo sapiens'
ClassCLASS A
FamilyADRENERGIC RECEPTORS
Sub-FamilyA2B
Cross References:
References
UniProtP18089 | Q4TUH9 | Q53RF2 | Q9BZK0
EMBLM34041 | AF316895 | AF005900 | AY548167 | DQ057076 | AC092603 | M38742
InterProIPR000276 | IPR015695 | IPR000207 | IPR002233 | IPR017452
PRODOM
GENEID151
MIM104260
PRINTSPR01103 | PR00559 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADRENERGIC RECEPTORS_A2B_Homo sapiens
DescriptionRecName: Full=Alpha-2B adrenergic receptor;AltName: Full=Alpha-2B adrenoreceptor;AltName: Full=Alpha-2B adrenoceptor;AltName: Full=Alpha-2 adrenergic receptor subtype C2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRA2B | ADRA2L1,ADRA2RL
FunctionAlpha-2 adrenergic receptors mediate the catecholamine-s induced inhibition of adenylate cyclase through the action of Gs proteins
Fragment0
Sequence
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o2164221
2Galpha-z_Homo sapiensGi/o2164221
3Galpha-i1_Homo sapiensGi/o2164221
4Galpha-o_Homo sapiensGi/o2164221
5Galpha-i2_Homo sapiensGi/o2164221
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level