Quick search:







Description Entry page for GPCR - 'ADRENERGIC RECEPTORS_A2C_Homo sapiens'
ClassCLASS A
FamilyADRENERGIC RECEPTORS
Sub-FamilyA2C
Cross References:
References
UniProtP18825 | P35369 | Q9HB49
EMBLJ03853 | U72648 | D13538 | AF280399 | AF280400 | AY605898 | AY455666 | X59684
InterProIPR000276 | IPR015695 | IPR000735 | IPR002233 | IPR017452
PRODOM
GENEID152
MIM104250
PRINTSPR01103 | PR00560 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADRENERGIC RECEPTORS_A2C_Homo sapiens
DescriptionRecName: Full=Alpha-2C adrenergic receptor;AltName: Full=Alpha-2C adrenoreceptor;AltName: Full=Alpha-2C adrenoceptor;AltName: Full=Alpha-2 adrenergic receptor subtype C4
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRA2C | ADRA2L2,ADRA2RL
FunctionAlpha-2 adrenergic receptors mediate the catecholamine-s induced inhibition of adenylate cyclase through the action of Gs proteins
Fragment0
Sequence
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o2842764
2Galpha-i3_Homo sapiensGi/o2842764
3Galpha-z_Homo sapiensGi/o2842764
4Galpha-i2_Homo sapiensGi/o2842764
5Galpha-o_Homo sapiensGi/o2842764
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level