Quick search:







Description Entry page for GPCR - 'ADRENERGIC RECEPTORS_B1_Homo sapiens'
ClassCLASS A
FamilyADRENERGIC RECEPTORS
Sub-FamilyB1
Cross References:
References
UniProtP08588 | B0LPE2 | Q5T5Y4 | Q9UKG7 | Q9UKG8
EMBLJ03019 | AF169006 | AF169007 | AY567837 | EU332832 | AL355543
InterProIPR000276 | IPR000507 | IPR002233 | IPR017452
PRODOM
GENEID153
MIM109630 | 607276
PRINTSPR01103 | PR00561 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameADRENERGIC RECEPTORS_B1_Homo sapiens
DescriptionRecName: Full=Beta-1 adrenergic receptor;AltName: Full=Beta-1 adrenoreceptor; Short=Beta-1 adrenoceptor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRB1 | ADRB1R,B1A
FunctionBeta-adrenergic receptors mediate the catecholamine-s induced activation of adenylate cyclase through the action of Gs proteins
Fragment0
Sequence
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-s_Homo sapiens_1Gs2825170
2Galpha-s_Homo sapiens_2Gs2825170
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level