Quick search:







Description Entry page for GPCR - 'ANAPHYLATOXIN RECEPTORS_C3a_Homo sapiens'
ClassCLASS A
FamilyANAPHYLATOXIN RECEPTORS
Sub-FamilyC3a
Cross References:
References
UniProtQ16581 | O43771 | Q92868
EMBLU28488 | Z73157 | U62027 | AB065870 | AY268431 | AY455929 | BC020742
InterProIPR000276 | IPR002234 | IPR001644 | IPR017452
PRODOM
GENEID719
MIM605246
PRINTSPR01104 | PR01060 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameANAPHYLATOXIN RECEPTORS_C3a_Homo sapiens
DescriptionRecName: Full=C3a anaphylatoxin chemotactic receptor; Short=C3a-R; Short=C3AR
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneC3AR1 | AZ3B,C3R1,HNFAG0
FunctionReceptor for the chemotactic and inflammatory peptides anaphylatoxin C3a
Fragment0
Sequence
MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIW
FLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDR
CLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSS
SLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSAD
SLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSA
SSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIV
FRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVC
IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNST
TV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i1_Homo sapiensGi/o8702752
2Galpha-12_Homo sapiensG12/138702752
3Galpha-o_Homo sapiensGi/o8702752
4Galpha-z_Homo sapiensGi/o8702752
5Galpha-i2_Homo sapiensGi/o8702752
6Galpha-13_Homo sapiensG12/138702752
7Galpha-i3_Homo sapiensGi/o8702752
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level