Quick search:







Description Entry page for GPCR - 'ANAPHYLATOXIN RECEPTORS_C5a_Homo sapiens'
ClassCLASS A
FamilyANAPHYLATOXIN RECEPTORS
Sub-FamilyC5a
Cross References:
References
UniProtP21730
EMBLX57250 | X58674 | M62505 | AY221091 | BT007358 | AC099491 | BC008982 | S56556 | S56557
InterProIPR000276 | IPR002234 | IPR001274 | IPR017452
PRODOM
GENEID728
MIM113995
PRINTSPR01104 | PR00426 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameANAPHYLATOXIN RECEPTORS_C5a_Homo sapiens
DescriptionRecName: Full=C5a anaphylatoxin chemotactic receptor; Short=C5a-R; Short=C5aR;AltName: CD_antigen=CD88
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneC5AR1 | C5AR,C5R
FunctionReceptor for the chemotactic and inflammatory peptides anaphylatoxin C5a
Fragment0
Sequence
MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-o_Homo sapiensGi/o7887933
2Galpha-i2_Homo sapiensGi/o7887933
3Galpha-14_Homo sapiensGq/117870028
4Galpha-11_Homo sapiensGq/117870028
5Galpha-15_Homo sapiensGq/117870028
6Galpha-z_Homo sapiensGi/o7887933
7Galpha-q_Homo sapiensGq/117870028
8Galpha-i3_Homo sapiensGi/o7887933
9Galpha-i1_Homo sapiensGi/o7887933
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level