Quick search:







Description Entry page for GPCR - 'ANGIOTENSIN RECEPTORS_AT2_Homo sapiens'
ClassCLASS A
FamilyANGIOTENSIN RECEPTORS
Sub-FamilyAT2
Cross References:
References
UniProtP50052 | B2R9V1 | Q13016 | Q6FGY7
EMBLU20860 | L34579 | U10273 | U15592 | U16957 | U27478 | AY536522 | AY322542 | AY324607 | CR541969 | AK313927 | AL732602 | CH471234 | BC095504 | X87723
InterProIPR000276 | IPR000147 | IPR000248 | IPR017452
PRODOM
GENEID186
MIM300034
PRINTSPR00241 | PR00636 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameANGIOTENSIN RECEPTORS_AT2_Homo sapiens
DescriptionRecName: Full=Type-2 angiotensin II receptor;AltName: Full=AT2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneAGTR
FunctionReceptor for angiotensin II
Fragment0
Sequence
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o8663053
2Galpha-o_Homo sapiensGi/o8663053
3Galpha-i1_Homo sapiensGi/o8663053
4Galpha-z_Homo sapiensGi/o8663053
5Galpha-i3_Homo sapiensGi/o8663053
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level