Quick search:







Description Entry page for GPCR - 'APELIN RECEPTORS_APJ_Homo sapiens'
ClassCLASS A
FamilyAPELIN RECEPTORS
Sub-FamilyAPJ
Cross References:
References
UniProtP35414
EMBLU03642 | X89271 | BC032688
InterProIPR000276 | IPR020279 | IPR003904 | IPR017452
PRODOM
GENEID187
MIM600052
PRINTSPR01416 | PR00237
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameAPELIN RECEPTORS_APJ_Homo sapiens
DescriptionRecName: Full=Apelin receptor;AltName: Full=G-protein coupled receptor APJ;AltName: Full=Angiotensin receptor-like 1;AltName: Full=HG11
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneAPLNR | AGTRL1,AP
FunctionReceptor for apelin coupled to G proteins that inhibits adenylate cyclase activity
Fragment0
Sequence
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK
RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL
TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ
CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL
RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV
NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK
GGEQMHEKSIPYSQETLVVD
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i2_Homo sapiensGi/o9792798
2Galpha-o_Homo sapiensGi/o9792798
3Galpha-i1_Homo sapiensGi/o9792798
4Galpha-i3_Homo sapiensGi/o9792798
5Galpha-z_Homo sapiensGi/o9792798
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level