Quick search:







Description Entry page for G-protein - 'Galpha-11_Homo sapiens'
ClassGalpha
FamilyGq/11
Sub-FamilyGalpha-11
TypeGalpha-11
Cross References:
References
UniProtP29992 | O15109 | Q14350 | Q6IB00
EMBLM69013 | AF011497 | AF493900 | CR457004 | AC005262 | BC089041 | BC096225 | BC096226 | BC096227 | L40630
InterProIPR001019 | IPR000654
PRODOMPD000281
GENEID2767
MIM139313
PRINTSPR00318 | PR00442
PFAMPF00503
Details:
Details
NameGalpha-11_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit alpha-11; Short=G-protein subunit alpha-11; Short=G alpha-11;AltName: Full=Guanine nucleotide-binding protein G(y) subunit alpha
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNA11 | GA1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
Effectors:
Effectors
NoNameRegulationPubMed
1GRK4-Homo sapiensStimulation15251227 | 14654303
2GRK3-Homo sapiensStimulation15251227 | 14654303 | 16182515
3Phospholipase C beta 1-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
4Phospholipase C beta 4-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
5GRK2-Homo sapiensInhibits PLC-beta activation and blocks Gqa-mediated GLUT4 translocation and glucose uptake in 3T3 adipocytes15251227 | 14654303 | 16182515
6Phospholipase C beta 2-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
7Phospholipase C beta 3-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed