Quick search:







Description Entry page for G-protein - 'Galpha-o_Homo sapiens'
ClassGalpha
FamilyGi/o
Sub-FamilyGalpha-o
TypeGalpha-o
Cross References:
References
UniProtP09471 | P29777 | Q8TD72 | Q9UMV4
EMBLM60164 | M60156 | M60157 | M60158 | M60159 | M60160 | M60163 | M60162 | M60156 | M60157 | M60158 | M60159 | M60160 | M60161 | M19182 | M19184 | AF493894 | AF493895 | Y18213
InterProIPR001019 | IPR001408
PRODOMPD000281
GENEID2775
MIM139311
PRINTSPR00318 | PR00441
PFAMPF00503
Details:
Details
NameGalpha-o_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(o) subunit alpha
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAO
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-26Stimulation of GTPase activity10224115 | 15251227 | 16380086
2Tubulin-Homo sapiens-17Stimulation of GTPase activity10224115 | 15251227 | 16380086
3Tubulin-Homo sapiens-23Stimulation of GTPase activity10224115 | 15251227 | 16380086
4Tubulin-Homo sapiens-4Stimulation of GTPase activity10224115 | 15251227 | 16380086
5Tubulin-Homo sapiens-7Stimulation of GTPase activity10224115 | 15251227 | 16380086
6Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246 | 11395521
7Tubulin-Homo sapiens-13Stimulation of GTPase activity10224115 | 15251227 | 16380086
8Tubulin-Homo sapiens-11Stimulation of GTPase activity10224115 | 15251227 | 16380086
9Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
10G-protein-regulated inducer of neurite outgrowth GRIN1-Homo sapiensUnknown15251227 | 10480904 | 14671004
11Tubulin-Homo sapiens-24Stimulation of GTPase activity10224115 | 15251227 | 16380086
12Tubulin-Homo sapiens-6Stimulation of GTPase activity10224115 | 15251227 | 16380086
13Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
14Tubulin-Homo sapiens-19Stimulation of GTPase activity10224115 | 15251227 | 16380086
15G-protein-regulated inducer of neurite outgrowth GRIN2-Homo sapiensUnknown15251227 | 10480904 | 14671004
16Tubulin-Homo sapiens-15Stimulation of GTPase activity10224115 | 15251227 | 16380086
17Tubulin-Homo sapiens-25Stimulation of GTPase activity10224115 | 15251227 | 16380086
18Tubulin-Homo sapiens-3Stimulation of GTPase activity10224115 | 15251227 | 16380086
19Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
20Tubulin-Homo sapiens-16Stimulation of GTPase activity10224115 | 15251227 | 16380086
21Tubulin-Homo sapiens-21Stimulation of GTPase activity10224115 | 15251227 | 16380086
22Tubulin-Homo sapiens-2Stimulation of GTPase activity10224115 | 15251227 | 16380086
23Tubulin-Homo sapiens-8Stimulation of GTPase activity10224115 | 15251227 | 16380086
24Tubulin-Homo sapiens-1Stimulation of GTPase activity10224115 | 15251227 | 16380086
25Src tyrosine kinase-Homo sapiens-2Stimulation11007482 | 15251227 | 12209124
26Tubulin-Homo sapiens-14Stimulation of GTPase activity10224115 | 15251227 | 16380086
27Tubulin-Homo sapiens-18Stimulation of GTPase activity10224115 | 15251227 | 16380086
28Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
29Tubulin-Homo sapiens-12Stimulation of GTPase activity10224115 | 15251227 | 16380086
30Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
31Tubulin-Homo sapiens-27Stimulation of GTPase activity10224115 | 15251227 | 16380086
32Tubulin-Homo sapiens-10Stimulation of GTPase activity10224115 | 15251227 | 16380086
33Tubulin-Homo sapiens-9Stimulation of GTPase activity10224115 | 15251227 | 16380086
34Tubulin-Homo sapiens-20Stimulation of GTPase activity10224115 | 15251227 | 16380086
35Tubulin-Homo sapiens-22Stimulation of GTPase activity10224115 | 15251227 | 16380086
36Src tyrosine kinase-Homo sapiens-1Stimulation11007482 | 15251227 | 12209124
37Tubulin-Homo sapiens-5Stimulation of GTPase activity10224115 | 15251227 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed