Quick search:







Description Entry page for G-protein - 'Galpha-q_Homo sapiens'
ClassGalpha
FamilyGq/11
Sub-FamilyGalpha-q
TypeGalpha-q
Cross References:
References
UniProtP50148 | O15108 | Q13462 | Q6NT27 | Q92471 | Q9BZB9
EMBLU40038 | U43083 | L76256 | AF329284 | AF011496 | AF493896 | AL160268 | AL160278 | AL355535 | AL355535 | AL160268 | AL160278 | AL160278 | AL160268 | AL355535 | CH471089 | BC057777 | BC067850 | BC069520 | BC075096 | BC075097 | L40629
InterProIPR001019 | IPR000654
PRODOMPD000281
GENEID2776
MIM600998
PRINTSPR00318 | PR00442
PFAMPF00503
Details:
Details
NameGalpha-q_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(q) subunit alpha;AltName: Full=Guanine nucleotide-binding protein alpha-q
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAQ | GA
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-13Potentiates receptor-induced PLC-beta activation16182515
2EBP50/NHERF 1-Homo sapiensInhibits PLC-beta activation and blocks Gqa-induce Tph and CXCR4 receptor internalization16182515
3Protein kinase D-Homo sapiensStimulation10636921
4Tubulin-Homo sapiens-23Potentiates receptor-induced PLC-beta activation16182515
5Tubulin-Homo sapiens-12Potentiates receptor-induced PLC-beta activation16182515
6Phospholipase C beta 3-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
7Tubulin-Homo sapiens-8Potentiates receptor-induced PLC-beta activation16182515
8Tubulin-Homo sapiens-19Potentiates receptor-induced PLC-beta activation16182515
9PI3K alpha-Homo sapiensInhibition of PI3K kinase activity in vitro16182515
10GRK2-Homo sapiensInhibits PLC-beta activation and blocks Gqa-mediated GLUT4 translocation and glucose uptake in 3T3 adipocytes15251227 | 14654303 | 16182515
11Tubulin-Homo sapiens-15Potentiates receptor-induced PLC-beta activation16182515
12Tubulin-Homo sapiens-1Potentiates receptor-induced PLC-beta activation16182515
13Brutons tyrosine kinase-Homo sapiensStimulation (indirect stimulation of p38 MAPK)15251227 | 9305846 | 16182515
14TPR repeat protein 1-Homo sapiensG16a co-expression enhances TPR1 interaction with Ras16182515 | 12748287
15PI3K beta-Homo sapiensInhibition of PI3K kinase activity in vitro16182515
16Tubulin-Homo sapiens-11Potentiates receptor-induced PLC-beta activation16182515
17Tubulin-Homo sapiens-7Potentiates receptor-induced PLC-beta activation16182515
18Tubulin-Homo sapiens-22Potentiates receptor-induced PLC-beta activation16182515
19Tubulin-Homo sapiens-5Potentiates receptor-induced PLC-beta activation16182515
20Tubulin-Homo sapiens-18Potentiates receptor-induced PLC-beta activation16182515
21Phospholipase C beta 2-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
22Tubulin-Homo sapiens-4Potentiates receptor-induced PLC-beta activation16182515
23Synembryn(Ric8a)-Homo sapiensStimulates Gqa activation and steady-state GTPase activity in vitro16182515 | 12509430
24Tubulin-Homo sapiens-20Potentiates receptor-induced PLC-beta activation16182515
25GRK3-Homo sapiensStimulation15251227 | 14654303 | 16182515
26Tubulin-Homo sapiens-21Potentiates receptor-induced PLC-beta activation16182515
27Tubulin-Homo sapiens-14Potentiates receptor-induced PLC-beta activation16182515
28Tubulin-Homo sapiens-3Potentiates receptor-induced PLC-beta activation16182515
29PI3K gamma-Homo sapiensInhibition of PI3K kinase activity in vitro16182515
30Tubulin-Homo sapiens-16Potentiates receptor-induced PLC-beta activation16182515
31Tubulin-Homo sapiens-6Potentiates receptor-induced PLC-beta activation16182515
32Phospholipase C beta 4-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
33Tubulin-Homo sapiens-24Potentiates receptor-induced PLC-beta activation16182515
34LARG RhoGEF-Homo sapiensStimulation (indirect activation of Rho)15251227 | 12024019
35PDZ RhoGEF-Homo sapiensNo data1525227 | 16182515
36Tubulin-Homo sapiens-9Potentiates receptor-induced PLC-beta activation16182515
37Tubulin-Homo sapiens-27Potentiates receptor-induced PLC-beta activation16182515
38Tubulin-Homo sapiens-25Potentiates receptor-induced PLC-beta activation16182515
39Tubulin-Homo sapiens-26Potentiates receptor-induced PLC-beta activation16182515
40Lbc RhoGEF-Homo sapiensNo functional effects identified16182515
41Phospholipase C beta 1-Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
42p115 RhoGEF-Homo sapiensNo data1525227 | 16182515
43Tubulin-Homo sapiens-10Potentiates receptor-induced PLC-beta activation16182515
44Tubulin-Homo sapiens-2Potentiates receptor-induced PLC-beta activation16182515
45Tubulin-Homo sapiens-17Potentiates receptor-induced PLC-beta activation16182515
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed