Quick search:







Description Entry page for G-protein - 'Galpha-s_Homo sapiens_1'
ClassGalpha
FamilyGs
Sub-FamilyGalpha-s
TypeGalpha-s
Cross References:
References
UniProtQ5JWF2 | A2A2S3 | O75684 | O75685 | Q5JW67 | Q5JWF1 | Q9NY42
EMBLAL109840 | AL121917 | AL132655 | AL109840 | AL121917 | AL132655 | AL121917 | AL109840 | AL132655 | AL121917 | AL109840 | AL132655 | AL132655 | AL109840 | AL121917 | AL132655 | AL109840 | AL121917 | AL132655 | AJ251760 | AJ224867 | AJ224868 | AY898804
InterProIPR001019 | IPR000367
PRODOMPD000281
GENEID2778
MIM139320 | 219080 | 603233
PRINTSPR00318 | PR00443
PFAMPF00503
Details:
Details
NameGalpha-s_Homo sapiens_1
DescriptionRecName: Full=Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas;AltName: Full=Adenylate cyclase-stimulating G alpha protein;AltName: Full=Extra large alphas protein; Short=XLalphas
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAS | GNAS
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIP
VENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPEEAMPFEAEQPSLGGFWPTLEQ
PGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPP
GLSRVIAQVDGSSQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSQEAVRPPSNFTGSSP
WMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE
MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADP
DSGAFAADPDSGAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAA
ETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP
PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRR
RKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEKRAQKR
AEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDP
QAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNV
PDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDL
LRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVI
REDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFAR
YTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFN
DCRDIIQRMHLRQYELL
Effectors:
Effectors
NoNameRegulationPubMed
1Adenylate cyclase 3-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
2Tubulin-Homo sapiens-13Stimulation of GTPase activity10224115 | 15251227 | 16380086
3Tubulin-Homo sapiens-16Stimulation of GTPase activity10224115 | 15251227 | 16380086
4Tubulin-Homo sapiens-15Stimulation of GTPase activity10224115 | 15251227 | 16380086
5Tubulin-Homo sapiens-24Stimulation of GTPase activity10224115 | 15251227 | 16380086
6Tubulin-Homo sapiens-14Stimulation of GTPase activity10224115 | 15251227 | 16380086
7Tubulin-Homo sapiens-11Stimulation of GTPase activity10224115 | 15251227 | 16380086
8Adenylate cyclase 1-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
9Tubulin-Homo sapiens-20Stimulation of GTPase activity10224115 | 15251227 | 16380086
10Src tyrosine kinase-Homo sapiens-2Stimulation11007482 | 15251227 | 12209124
11Tubulin-Homo sapiens-1Stimulation of GTPase activity10224115 | 15251227 | 16380086
12Tubulin-Homo sapiens-27Stimulation of GTPase activity10224115 | 15251227 | 16380086
13Tubulin-Homo sapiens-23Stimulation of GTPase activity10224115 | 15251227 | 16380086
14Src tyrosine kinase-Homo sapiens-1Stimulation11007482 | 15251227 | 12209124
15Tubulin-Homo sapiens-4Stimulation of GTPase activity10224115 | 15251227 | 16380086
16Adenylate cyclase 8-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
17Tubulin-Homo sapiens-25Stimulation of GTPase activity10224115 | 15251227 | 16380086
18Adenylate cyclase 9-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
19Tubulin-Homo sapiens-17Stimulation of GTPase activity10224115 | 15251227 | 16380086
20Tubulin-Homo sapiens-19Stimulation of GTPase activity10224115 | 15251227 | 16380086
21Tubulin-Homo sapiens-5Stimulation of GTPase activity10224115 | 15251227 | 16380086
22Tubulin-Homo sapiens-12Stimulation of GTPase activity10224115 | 15251227 | 16380086
23Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
24Tubulin-Homo sapiens-8Stimulation of GTPase activity10224115 | 15251227 | 16380086
25Tubulin-Homo sapiens-10Stimulation of GTPase activity10224115 | 15251227 | 16380086
26Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
27Adenylate cyclase 5-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
28Tubulin-Homo sapiens-9Stimulation of GTPase activity10224115 | 15251227 | 16380086
29Tubulin-Homo sapiens-2Stimulation of GTPase activity10224115 | 15251227 | 16380086
30Tubulin-Homo sapiens-6Stimulation of GTPase activity10224115 | 15251227 | 16380086
31Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
32Tubulin-Homo sapiens-22Stimulation of GTPase activity10224115 | 15251227 | 16380086
33RGS PX1-Homo sapiensStimulation15251227
34Tubulin-Homo sapiens-21Stimulation of GTPase activity10224115 | 15251227 | 16380086
35Tubulin-Homo sapiens-7Stimulation of GTPase activity10224115 | 15251227 | 16380086
36Tubulin-Homo sapiens-3Stimulation of GTPase activity10224115 | 15251227 | 16380086
37Adenylate cyclase 6-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
38Tubulin-Homo sapiens-26Stimulation of GTPase activity10224115 | 15251227 | 16380086
39Tubulin-Homo sapiens-18Stimulation of GTPase activity10224115 | 15251227 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed