Quick search:







Description Entry page for G-protein - 'Galpha-s_Homo sapiens_2'
ClassGalpha
FamilyGs
Sub-FamilyGalpha-s
TypeGalpha-s
Cross References:
References
UniProtP63092 | P04895 | Q12927 | Q14433 | Q32P26 | Q5JWD2 | Q5JWD4 | Q5JWD5
EMBLX04408 | X04409 | M21142 | M21139 | M21740 | M21140 | M21741 | M21141 | M21142 | M21139 | M21740 | M21140 | M21741 | M21141 | M21142 | M21139 | M21141 | M21740 | M21741 | M21142 | M21139 | M21740 | M21741 | M21141 | U12466 | X07036 | AF493897 | AF493898 | BT009905 | AL109840 | AL121917 | AL109840 | AL121917 | AL109840 | AL121917 | AL109840 | AL121917 | AL121917 | AL109840 | AL121917 | AL109840 | AL121917 | AL109840 | AL121917 | AL109840 | CH471077 | BC002722 | BC008855 | BC066923 | BC022875 | BC104928 | BC108315 | M14631
InterProIPR001019 | IPR000367
PRODOMPD000281
GENEID2778
MIM102200 | 103580 | 139320 | 166350 | 174800 | 219080 | 603233
PRINTSPR00318 | PR00443
PFAMPF00503
Details:
Details
NameGalpha-s_Homo sapiens_2
DescriptionRecName: Full=Guanine nucleotide-binding protein G(s) subunit alpha isoforms short;AltName: Full=Adenylate cyclase-stimulating G alpha protein
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAS | GNAS1,GS
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA
NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND
VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK
VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
Effectors:
Effectors
NoNameRegulationPubMed
1Adenylate cyclase 3-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
2Tubulin-Homo sapiens-21Stimulation of GTPase activity10224115 | 15251227 | 16380086
3Tubulin-Homo sapiens-20Stimulation of GTPase activity10224115 | 15251227 | 16380086
4Adenylate cyclase 5-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
5Tubulin-Homo sapiens-5Stimulation of GTPase activity10224115 | 15251227 | 16380086
6RGS PX1-Homo sapiensStimulation15251227
7Tubulin-Homo sapiens-9Stimulation of GTPase activity10224115 | 15251227 | 16380086
8Tubulin-Homo sapiens-17Stimulation of GTPase activity10224115 | 15251227 | 16380086
9Tubulin-Homo sapiens-16Stimulation of GTPase activity10224115 | 15251227 | 16380086
10Tubulin-Homo sapiens-6Stimulation of GTPase activity10224115 | 15251227 | 16380086
11Adenylate cyclase 6-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
12Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
13Tubulin-Homo sapiens-10Stimulation of GTPase activity10224115 | 15251227 | 16380086
14Tubulin-Homo sapiens-15Stimulation of GTPase activity10224115 | 15251227 | 16380086
15Tubulin-Homo sapiens-11Stimulation of GTPase activity10224115 | 15251227 | 16380086
16Tubulin-Homo sapiens-7Stimulation of GTPase activity10224115 | 15251227 | 16380086
17Src tyrosine kinase-Homo sapiens-2Stimulation11007482 | 15251227 | 12209124
18Tubulin-Homo sapiens-1Stimulation of GTPase activity10224115 | 15251227 | 16380086
19Tubulin-Homo sapiens-19Stimulation of GTPase activity10224115 | 15251227 | 16380086
20Tubulin-Homo sapiens-2Stimulation of GTPase activity10224115 | 15251227 | 16380086
21Tubulin-Homo sapiens-13Stimulation of GTPase activity10224115 | 15251227 | 16380086
22Tubulin-Homo sapiens-4Stimulation of GTPase activity10224115 | 15251227 | 16380086
23Tubulin-Homo sapiens-22Stimulation of GTPase activity10224115 | 15251227 | 16380086
24Tubulin-Homo sapiens-27Stimulation of GTPase activity10224115 | 15251227 | 16380086
25Tubulin-Homo sapiens-3Stimulation of GTPase activity10224115 | 15251227 | 16380086
26Tubulin-Homo sapiens-18Stimulation of GTPase activity10224115 | 15251227 | 16380086
27Adenylate cyclase 9-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
28Tubulin-Homo sapiens-26Stimulation of GTPase activity10224115 | 15251227 | 16380086
29Tubulin-Homo sapiens-12Stimulation of GTPase activity10224115 | 15251227 | 16380086
30Adenylate cyclase 8-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
31Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
32Adenylate cyclase 1-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
33Tubulin-Homo sapiens-14Stimulation of GTPase activity10224115 | 15251227 | 16380086
34Tubulin-Homo sapiens-8Stimulation of GTPase activity10224115 | 15251227 | 16380086
35Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
36Tubulin-Homo sapiens-23Stimulation of GTPase activity10224115 | 15251227 | 16380086
37Src tyrosine kinase-Homo sapiens-1Stimulation11007482 | 15251227 | 12209124
38Tubulin-Homo sapiens-25Stimulation of GTPase activity10224115 | 15251227 | 16380086
39Tubulin-Homo sapiens-24Stimulation of GTPase activity10224115 | 15251227 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed