Quick search:







Description Entry page for G-protein - 'Galpha-t2_Homo sapiens'
ClassGalpha
FamilyGi/o
Sub-FamilyGalpha-t
TypeGalpha-t2
Cross References:
References
UniProtP19087
EMBLD10384 | Z18859 | AF493909 | BC000233
InterProIPR001019 | IPR001408
PRODOMPD000281
GENEID2780
MIM139340
PRINTSPR00318 | PR00441
PFAMPF00503
Details:
Details
NameGalpha-t2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(t) subunit alpha-2;AltName: Full=Transducin alpha-2 chain
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAT2 | GNAT
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDG
YSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMP
PELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVK
TTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEV
NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Effectors:
Effectors
NoNameRegulationPubMed
1Phosphodiesterase 6-Homo sapiens-2Stimulation15251227 | 15988071 | 14699118
2Phosphodiesterase 6-Homo sapiens-4Stimulation15251227 | 15988071 | 14699118
3Phosphodiesterase 6-Homo sapiens-5Stimulation15251227 | 15988071 | 14699118
4Phosphodiesterase 6-Homo sapiens-1Stimulation15251227 | 15988071 | 14699118
5Phosphodiesterase 6-Homo sapiens-3Stimulation15251227 | 15988071 | 14699118
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed