Quick search:







Description Entry page for G-protein - 'Galpha-t3_Homo sapiens'
ClassGalpha
FamilyGi/o
Sub-FamilyGalpha-t
TypeGalpha-t3
Cross References:
References
UniProtA8MTJ3 | A4D1B2 | A4D1B3
EMBLAC004862 | CH236949 | CH236949
InterProIPR001019 | IPR001408
PRODOMPD000281
GENEID346562
MIM139395
PRINTSPR00318 | PR00441
PFAMPF00503
Details:
Details
NameGalpha-t3_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(t) subunit alpha-3;AltName: Full=Gustducin alpha-3 chain
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNAT
FunctionGuanine nucleotide-binding protein (G protein) alphas subunit playing a prominent role in bitter and sweet tastes transduction as well as in umami (monosodium glutamate,s monopotassium glutamate, and inosine monophosphate) tastes transduction
Fragment0
Sequence
MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNG
YSEQECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMT
PQLAEVIKRLWRDPGIQACFERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVK
TTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDEEV
NRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTKVHLSICFPEYTGPNTFEDAG
NYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Effectors:
Effectors
NoNameRegulationPubMed
1Phosphodiesterase 6-Homo sapiens-3Stimulation15251227 | 15988071 | 14699118
2Phosphodiesterase 6-Homo sapiens-1Stimulation15251227 | 15988071 | 14699118
3Phosphodiesterase 6-Homo sapiens-2Stimulation15251227 | 15988071 | 14699118
4Phosphodiesterase 6-Homo sapiens-4Stimulation15251227 | 15988071 | 14699118
5Phosphodiesterase 6-Homo sapiens-5Stimulation15251227 | 15988071 | 14699118
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed