Quick search:







Description Entry page for G-protein - 'Gbeta-2_Homo sapiens'
ClassGbeta
FamilyGbeta
Sub-FamilyGbeta
TypeGbeta-2
Cross References:
References
UniProtP62879 | P11016 | P54312
EMBLM16514 | M36429 | M16538 | AF053356 | AF501883 | BC010073 | BC012348 | BC068003
InterProIPR020472 | IPR001632 | IPR016346 | IPR015943 | IPR001680 | IPR019782 | IPR019775 | IPR017986 | IPR019781
PRODOMPD000018
GENEID2783
MIM139390
PRINTSPR00319 | PR00320
PFAMPF00400
Details:
Details
NameGbeta-2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2;AltName: Full=Transducin beta chain 2;AltName: Full=G protein subunit beta-2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNB
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Effectors:
Effectors
NoNameRegulationPubMed
1Rho-Homo sapiens-3Recruitment to plasma membrane15251227
2ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
3Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
4Raf1 protein kinase-Homo sapiensSequestration of G15251227
5SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
6Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
8Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
9Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
11Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
12Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
13Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
15Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
16Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
19PI3K beta-Homo sapiensActivation9305878 | 12502714
20Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
21Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
23Rho-Homo sapiens-1Recruitment to plasma membrane15251227
24Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
25Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
26Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
27ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
28Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
30Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
31Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
34Protein kinase D-Homo sapiensStimulation15251227
35Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
38Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Rho-Homo sapiens-2Recruitment to plasma membrane15251227
40Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
41SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
42Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
43Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
44PI3K gamma-Homo sapiensActivation12502714
45Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46PI3K alpha-Homo sapiensPropable Inhibition16182515
47Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
50Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
55Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
56Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
57Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
59ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
60Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
61Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
62Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
63Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed