Quick search:







Description Entry page for G-protein - 'Gbeta-2_Homo sapiens'
ClassGbeta
FamilyGbeta
Sub-FamilyGbeta
TypeGbeta-2
Cross References:
References
UniProtP62879 | P11016 | P54312
EMBLM16514 | M36429 | M16538 | AF053356 | AF501883 | BC010073 | BC012348 | BC068003
InterProIPR020472 | IPR001632 | IPR016346 | IPR015943 | IPR001680 | IPR019782 | IPR019775 | IPR017986 | IPR019781
PRODOMPD000018
GENEID2783
MIM139390
PRINTSPR00319 | PR00320
PFAMPF00400
Details:
Details
NameGbeta-2_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2;AltName: Full=Transducin beta chain 2;AltName: Full=G protein subunit beta-2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNB
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
3Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
4Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
5PI3K gamma-Homo sapiensActivation12502714
6Rho-Homo sapiens-2Recruitment to plasma membrane15251227
7Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9Raf1 protein kinase-Homo sapiensSequestration of G15251227
10ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
11Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
16Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
17Rho-Homo sapiens-1Recruitment to plasma membrane15251227
18Rho-Homo sapiens-3Recruitment to plasma membrane15251227
19Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
20Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
23Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
25Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
26ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
27Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
28Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
30Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
31GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
32Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
33Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35PI3K beta-Homo sapiensActivation9305878 | 12502714
36Protein kinase D-Homo sapiensStimulation15251227
37Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
38Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
39Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
41Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
44Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
46Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
48Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49PI3K alpha-Homo sapiensPropable Inhibition16182515
50Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
51ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
52Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
54Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
55Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
57Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
59Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
62SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
63Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
64ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
65ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
66Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
68Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
69Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed