Quick search:







Description Entry page for G-protein - 'Galpha-12_Homo sapiens'
ClassGalpha
FamilyG12/13
Sub-FamilyGalpha-12
TypeGalpha-12
Cross References:
References
UniProtQ03113 | A4D204 | Q2T9L1 | Q86UM8 | Q8TD71 | Q9UDU9
EMBLL01694 | AF493901 | AC006028 | AC004933 | CH236953 | BC111464
InterProIPR001019 | IPR000469
PRODOMPD000281
GENEID2768
MIM604394
PRINTSPR00318 | PR00440
PFAMPF00503
Details:
Details
NameGalpha-12_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit alpha-12; Short=G-protein subunit alpha-12; Short=G alpha-12
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNA1
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment0
Sequence
MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQ
YSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVR
FVFHAVKDTILQENLKDIMLQ
Effectors:
Effectors
NoNameRegulationPubMed
1LARG RhoGEF-Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 12024019 | 14607242
2p115 RhoGEF-Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 14607242
3PDZ RhoGEF-Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 11799111 | 14607242
4E cadherin-Homo sapiensStimulation (stimulation of h-catenin release)15251227 | 14607242 | 11136230
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed