Quick search:







Description Entry page for G-protein - 'Gbeta-5_Homo sapiens'
ClassGbeta
FamilyGbeta
Sub-FamilyGbeta
TypeGbeta-5
Cross References:
References
UniProtO14775 | Q9HAU9
EMBLAF017656 | AF501885 | AF300650 | BC013997
InterProIPR020472 | IPR001632 | IPR016346 | IPR015943 | IPR001680 | IPR019782 | IPR019775 | IPR017986 | IPR019781
PRODOMPD000018
GENEID10681
MIM604447
PRINTSPR00319 | PR00320
PFAMPF00400
Details:
Details
NameGbeta-5_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit beta-5;AltName: Full=Transducin beta chain 5;AltName: Full=Gbeta5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNB
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSE
AESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI
VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDK
NENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADV
LCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGS
DDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV
SILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
5Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
7Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
8Raf1 protein kinase-Homo sapiensSequestration of G15251227
9SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
10ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
11Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
13Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
14Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
15Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
16Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
17Rho-Homo sapiens-2Recruitment to plasma membrane15251227
18Rho-Homo sapiens-1Recruitment to plasma membrane15251227
19Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
20Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22PI3K beta-Homo sapiensActivation9305878 | 12502714
23Rho-Homo sapiens-3Recruitment to plasma membrane15251227
24Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
25Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
26ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
27Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
30Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
33Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
34Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
35Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
37Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
38Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39PI3K gamma-Homo sapiensActivation12502714
40SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
41ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
42ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
43Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
45Protein kinase D-Homo sapiensStimulation15251227
46Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
47Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
49ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
50Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54PI3K alpha-Homo sapiensPropable Inhibition16182515
55Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
56Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
57Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
58Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
59Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
65ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
66ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
67Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
68Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
69Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed