Quick search:







Description Entry page for G-protein - 'Gbeta-5_Homo sapiens'
ClassGbeta
FamilyGbeta
Sub-FamilyGbeta
TypeGbeta-5
Cross References:
References
UniProtO14775 | Q9HAU9
EMBLAF017656 | AF501885 | AF300650 | BC013997
InterProIPR020472 | IPR001632 | IPR016346 | IPR015943 | IPR001680 | IPR019782 | IPR019775 | IPR017986 | IPR019781
PRODOMPD000018
GENEID10681
MIM604447
PRINTSPR00319 | PR00320
PFAMPF00400
Details:
Details
NameGbeta-5_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit beta-5;AltName: Full=Transducin beta chain 5;AltName: Full=Gbeta5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNB
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSE
AESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI
VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDK
NENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADV
LCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGS
DDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV
SILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
3ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
4Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
5Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
7Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
8Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
9Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10PI3K alpha-Homo sapiensPropable Inhibition16182515
11Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
12ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
13Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
14Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
15PI3K beta-Homo sapiensActivation9305878 | 12502714
16SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
17Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
19ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
20Raf1 protein kinase-Homo sapiensSequestration of G15251227
21PI3K gamma-Homo sapiensActivation12502714
22Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
23Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
24Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
26Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
27Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
28Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
29Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
31Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
32Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
35Protein kinase D-Homo sapiensStimulation15251227
36SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
37Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
39ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
40Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
41ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
42ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
43Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
44Rho-Homo sapiens-1Recruitment to plasma membrane15251227
45Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Rho-Homo sapiens-2Recruitment to plasma membrane15251227
47Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
48Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
51Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
52Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
55Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
56Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
57Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59Rho-Homo sapiens-3Recruitment to plasma membrane15251227
60Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
63Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
66Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
68Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed