Quick search:







Description Entry page for G-protein - 'Gbeta-5_Homo sapiens'
ClassGbeta
FamilyGbeta
Sub-FamilyGbeta
TypeGbeta-5
Cross References:
References
UniProtO14775 | Q9HAU9
EMBLAF017656 | AF501885 | AF300650 | BC013997
InterProIPR020472 | IPR001632 | IPR016346 | IPR015943 | IPR001680 | IPR019782 | IPR019775 | IPR017986 | IPR019781
PRODOMPD000018
GENEID10681
MIM604447
PRINTSPR00319 | PR00320
PFAMPF00400
Details:
Details
NameGbeta-5_Homo sapiens
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit beta-5;AltName: Full=Transducin beta chain 5;AltName: Full=Gbeta5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNB
FunctionGuanine nucleotide-binding proteins (G proteins) ares involved as a modulator or transducer in various transmembranes signaling systems
Fragment0
Sequence
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSE
AESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI
VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDK
NENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADV
LCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGS
DDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV
SILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
Effectors:
Effectors
NoNameRegulationPubMed
1ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
2Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
3ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
4Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
5Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
6Rho-Homo sapiens-2Recruitment to plasma membrane15251227
7Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
8SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
9GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
10Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
11PI3K beta-Homo sapiensActivation9305878 | 12502714
12Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
18Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
19Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
21Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
22Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
23Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
24SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
25Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
26ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
27Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28PI3K alpha-Homo sapiensPropable Inhibition16182515
29Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
31Rho-Homo sapiens-3Recruitment to plasma membrane15251227
32Protein kinase D-Homo sapiensStimulation15251227
33Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
34Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
36Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
37Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
40Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
41Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
42Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
44Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
45Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
46Rho-Homo sapiens-1Recruitment to plasma membrane15251227
47ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
48ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
49Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
51Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
52Raf1 protein kinase-Homo sapiensSequestration of G15251227
53Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
55Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
57Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
59GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
60Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
61Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64PI3K gamma-Homo sapiensActivation12502714
65Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
66Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
68Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed