Quick search:







Description Entry page for G-protein - 'Gbeta-like_Homo sapiens_2'
ClassGbeta
FamilyGbeta
Sub-FamilyGbeta
TypeGbeta-like
Cross References:
References
UniProtQ9BYB4 | Q9H2S2 | Q9H4M4
EMBLAF238328 | AF301895 | AY007378 | AB049212 | AB051432 | CR456496 | BC012060
InterProIPR015943 | IPR001680 | IPR019782 | IPR019775 | IPR017986 | IPR019781
PRODOM
GENEID54584
MIM610778
PRINTS
PFAMPF00400
Details:
Details
NameGbeta-like_Homo sapiens_2
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit beta-like protein 1; Short=G protein subunit beta-like protein 1;AltName: Full=WD40 repeat-containing protein deleted in VCFS; Short=Protein WDVCF;AltName: Full=WD repeat-containing protein 14;AltName: Full=DGCRK3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNB1L | GY2,KIAA1645,WDR14 | FKSG
Function
Fragment0
Sequence
MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAV
TTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSI
LAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPL
LLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQ
QALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQC
VAFTADGLLAAGSKDQRISLWSLYPRA
Effectors:
Effectors
NoNameRegulationPubMed
1Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
2Rho-Homo sapiens-2Recruitment to plasma membrane15251227
3Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
4ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
5Raf1 protein kinase-Homo sapiensSequestration of G15251227
6Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
8Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
9Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
11Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
12PI3K alpha-Homo sapiensPropable Inhibition16182515
13Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
14Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
16Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
17Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
18Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
19Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
22Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
23Rho-Homo sapiens-3Recruitment to plasma membrane15251227
24Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
26ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
27Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
29Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
30Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
31Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
32Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
33ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
34Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
35Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
37PI3K beta-Homo sapiensActivation9305878 | 12502714
38SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
39Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
40GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
41Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
42Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
43Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
44Rho-Homo sapiens-1Recruitment to plasma membrane15251227
45Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
47Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
48ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
49ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
50Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
51Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
52Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54Protein kinase D-Homo sapiensStimulation15251227
55Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
58Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
59PI3K gamma-Homo sapiensActivation12502714
60Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
61Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
62Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
63GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
64Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
66ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
67ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
68Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed