Quick search:







Description Entry page for G-protein - 'Gbeta-like_Homo sapiens_2'
ClassGbeta
FamilyGbeta
Sub-FamilyGbeta
TypeGbeta-like
Cross References:
References
UniProtQ9BYB4 | Q9H2S2 | Q9H4M4
EMBLAF238328 | AF301895 | AY007378 | AB049212 | AB051432 | CR456496 | BC012060
InterProIPR015943 | IPR001680 | IPR019782 | IPR019775 | IPR017986 | IPR019781
PRODOM
GENEID54584
MIM610778
PRINTS
PFAMPF00400
Details:
Details
NameGbeta-like_Homo sapiens_2
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit beta-like protein 1; Short=G protein subunit beta-like protein 1;AltName: Full=WD40 repeat-containing protein deleted in VCFS; Short=Protein WDVCF;AltName: Full=WD repeat-containing protein 14;AltName: Full=DGCRK3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNB1L | GY2,KIAA1645,WDR14 | FKSG
Function
Fragment0
Sequence
MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAV
TTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSI
LAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPL
LLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQ
QALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQC
VAFTADGLLAAGSKDQRISLWSLYPRA
Effectors:
Effectors
NoNameRegulationPubMed
1Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
2Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
3Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
4Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
5PI3K alpha-Homo sapiensPropable Inhibition16182515
6Protein kinase D-Homo sapiensStimulation15251227
7ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
8Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
9PI3K beta-Homo sapiensActivation9305878 | 12502714
10Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
11PI3K gamma-Homo sapiensActivation12502714
12Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
13Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
14Rho-Homo sapiens-2Recruitment to plasma membrane15251227
15SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
16Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
17GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
18Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
19Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
20Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
22Rho-Homo sapiens-1Recruitment to plasma membrane15251227
23ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
24Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
25Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
26Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
29Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
31GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
32Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
33Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
34ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
35Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
36Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
37Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
38Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
39SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
40Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
42Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
43Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
44ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
45Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
46Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
47Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
48Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
49ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
50Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
51Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
52Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
55Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
56Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
58Rho-Homo sapiens-3Recruitment to plasma membrane15251227
59Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
60ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
61Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
62Raf1 protein kinase-Homo sapiensSequestration of G15251227
63Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
65SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
66Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
67Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
68Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed