Quick search:







Description Entry page for G-protein - 'Gbeta-like_Homo sapiens_2'
ClassGbeta
FamilyGbeta
Sub-FamilyGbeta
TypeGbeta-like
Cross References:
References
UniProtQ9BYB4 | Q9H2S2 | Q9H4M4
EMBLAF238328 | AF301895 | AY007378 | AB049212 | AB051432 | CR456496 | BC012060
InterProIPR015943 | IPR001680 | IPR019782 | IPR019775 | IPR017986 | IPR019781
PRODOM
GENEID54584
MIM610778
PRINTS
PFAMPF00400
Details:
Details
NameGbeta-like_Homo sapiens_2
DescriptionRecName: Full=Guanine nucleotide-binding protein subunit beta-like protein 1; Short=G protein subunit beta-like protein 1;AltName: Full=WD40 repeat-containing protein deleted in VCFS; Short=Protein WDVCF;AltName: Full=WD repeat-containing protein 14;AltName: Full=DGCRK3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGNB1L | GY2,KIAA1645,WDR14 | FKSG
Function
Fragment0
Sequence
MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAV
TTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSI
LAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPL
LLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQ
QALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQC
VAFTADGLLAAGSKDQRISLWSLYPRA
Effectors:
Effectors
NoNameRegulationPubMed
1SHC transforming protein 2-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
2Tubulin-Homo sapiens-26Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
3Voltage dependent R type calcium channel-Homo sapiensInhibition15251227 | 11031246
4Phospholipase C beta 3-Homo sapiensStimulation15251227 | 11015615 | 8383116
5Tubulin-Homo sapiens-27Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
6Tubulin-Homo sapiens-10Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
7Adenylate cyclase 1-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
8ATP-sensitive inward rectifier potassium channel 1-Homo sapiensStimulation15251227 | 10990455
9Tubulin-Homo sapiens-17Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
10Adenylate cyclase 4-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
11PI3K alpha-Homo sapiensPropable Inhibition16182515
12ATP-sensitive inward rectifier potassium channel 11-Homo sapiensStimulation15251227 | 10990455
13Tubulin-Homo sapiens-14Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
14Tubulin-Homo sapiens-15Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
15Rac-Homo sapiens-2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
16Protein kinase D-Homo sapiensStimulation15251227
17ATP-sensitive inward rectifier potassium channel 14-Homo sapiensStimulation15251227 | 10990455
18Tubulin-Homo sapiens-20Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
19Calmodulin-Homo sapiensInhibition of calmodulin kinase15251227
20Tubulin-Homo sapiens-24Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
21ATP-sensitive inward rectifier potassium channel 12-Homo sapiensStimulation15251227 | 10990455
22Phospholipase C beta 2-Homo sapiensStimulation15251227 | 11015615 | 8383116
23Adenylate cyclase 2-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
24Tubulin-Homo sapiens-12Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
25Tsk tyrosine kinase-Homo sapiensStimulation15251227 | 14671004
26Tubulin-Homo sapiens-5Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
27Tubulin-Homo sapiens-11Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
28Tubulin-Homo sapiens-16Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
29Tubulin-Homo sapiens-1Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
30ATP-sensitive inward rectifier potassium channel 10-Homo sapiensStimulation15251227 | 10990455
31Tubulin-Homo sapiens-9Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
32Rac-Homo sapiens-3"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
33Rho-Homo sapiens-3Recruitment to plasma membrane15251227
34GRK2-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
35Tubulin-Homo sapiens-2Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
36Adenylate cyclase 5-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
37ATP-sensitive inward rectifier potassium channel 15-Homo sapiensStimulation15251227 | 10990455
38Kinase suppressor of Ras(KSR)-Homo sapiensSequestration of Gbeta/gamma15251227
39Tubulin-Homo sapiens-21Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
40Tubulin-Homo sapiens-4Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
41PI3K beta-Homo sapiensActivation9305878 | 12502714
42Adenylate cyclase 7-Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
43PI3K gamma-Homo sapiensActivation12502714
44ATP-sensitive inward rectifier potassium channel 8-Homo sapiensStimulation15251227 | 10990455
45Tubulin-Homo sapiens-3Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
46Tubulin-Homo sapiens-22Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
47Rac-Homo sapiens-1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
48SHC transforming protein 3-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
49Tubulin-Homo sapiens-19Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
50Adenylate cyclase 6-Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
51Dynamin 1-Homo sapiensIncreased GTPase activity15251227 | 14671004
52Tubulin-Homo sapiens-13Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
53Tubulin-Homo sapiens-18Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
54GRK3-Homo sapiensRecruitment to plasma membrane15251227 | 14654303
55Tubulin-Homo sapiens-25Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
56Tubulin-Homo sapiens-8Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
57Phospholipase C beta 1-Homo sapiensStimulation15251227 | 11015615 | 8383116
58SHC transforming protein 1-Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
59Voltage dependent N type calcium channel-Homo sapiensInhibition15251227 | 11031246
60Rho-Homo sapiens-1Recruitment to plasma membrane15251227
61Tubulin-Homo sapiens-23Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
62Ras specific nucleotide exchange factor CDC25-Homo sapiensStimulation (indirect activation of ras)15251227 | 8717044
63Tubulin-Homo sapiens-7Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
64Raf1 protein kinase-Homo sapiensSequestration of G15251227
65Cdc42-Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
66Rho-Homo sapiens-2Recruitment to plasma membrane15251227
67Brutons tyrosine kinase-Homo sapiensStimulation15251227 | 11698416
68Tubulin-Homo sapiens-6Increased GTPase activity15251227 | 14671004 | 12807915 | 17705289 | 16380086
69Voltage dependent P/Q type calcium channel-Homo sapiensInhibition15251227 | 11031246
Interacton with GPCRs:
Coupling with GPCRs
NoNameCouplingPubMed